KDM8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11606T
Artikelname: KDM8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11606T
Hersteller Artikelnummer: CNA11606T
Alternativnummer: MBL-CNA11606T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 147-416 of human KDM8 (NP_079049.2).
Konjugation: Unconjugated
Alternative Synonym: JMJD5
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 79831
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: THLPGKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWH
Target-Kategorie: KDM8
Application Verdünnung: WB: WB,1:500 - 1:2000