MAT2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11608T
Artikelname: MAT2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11608T
Hersteller Artikelnummer: CNA11608T
Alternativnummer: MBL-CNA11608T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MAT2B (NP_037415.1).
Konjugation: Unconjugated
Alternative Synonym: TGR, MAT-II, SDR23E1, MATIIbeta, Nbla02999
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 27430
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNE
Target-Kategorie: MAT2B
Application Verdünnung: WB: WB,1:500 - 1:2000