ACTN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1160S
Artikelname: ACTN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1160S
Hersteller Artikelnummer: CNA1160S
Alternativnummer: MBL-CNA1160S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human ACTN1 (NP_001123477.1).
Konjugation: Unconjugated
Alternative Synonym: BDPLT15
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 87
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQK
Target-Kategorie: ACTN1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200