CBS Rabbit mAb, Clone: [ARC0643], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11612S
Artikelname: CBS Rabbit mAb, Clone: [ARC0643], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11612S
Hersteller Artikelnummer: CNA11612S
Alternativnummer: MBL-CNA11612S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520).
Konjugation: Unconjugated
Alternative Synonym: CBSL, HIP4
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0643]
Molekulargewicht: 61kDa
NCBI: 875
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Target-Kategorie: CBS
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200