OCIAD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11630T
Artikelname: OCIAD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11630T
Hersteller Artikelnummer: CNA11630T
Alternativnummer: MBL-CNA11630T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human OCIAD1 (NP_060300.1).
Konjugation: Unconjugated
Alternative Synonym: OCIA, ASRIJ, TPA018
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 54940
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Target-Kategorie: OCIAD1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200