GABRA3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11636T
Artikelname: GABRA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11636T
Hersteller Artikelnummer: CNA11636T
Alternativnummer: MBL-CNA11636T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-276 of human GABRA3 (NP_000799.1).
Konjugation: Unconjugated
Alternative Synonym: EPILX2
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 2556
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIG
Target-Kategorie: GABRA3
Application Verdünnung: WB: WB,1:500 - 1:2000