Kininogen 1 (KNG1) Rabbit mAb, Clone: [ARC0653], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11638S
Artikelname: Kininogen 1 (KNG1) Rabbit mAb, Clone: [ARC0653], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11638S
Hersteller Artikelnummer: CNA11638S
Alternativnummer: MBL-CNA11638S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1).
Konjugation: Unconjugated
Alternative Synonym: BK, HK, BDK, KNG, HAE6, HMWK
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0653]
Molekulargewicht: 44kDa/48kDa/72kDa
NCBI: 3827
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS
Target-Kategorie: KNG1
Application Verdünnung: WB: WB,1:500 - 1:1000