NEDD8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1163S
Artikelname: NEDD8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1163S
Hersteller Artikelnummer: CNA1163S
Alternativnummer: MBL-CNA1163S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NEDD8 (NP_006147.1).
Konjugation: Unconjugated
Alternative Synonym: NEDD-8
Klonalität: Polyclonal
Molekulargewicht: 9kDa
NCBI: 4738
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Target-Kategorie: NEDD8
Application Verdünnung: WB: WB,1:500 - 1:2000