GluR1/GRIA1 Rabbit mAb, Clone: [ARC0657], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11643S
Artikelname: GluR1/GRIA1 Rabbit mAb, Clone: [ARC0657], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11643S
Hersteller Artikelnummer: CNA11643S
Alternativnummer: MBL-CNA11643S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261).
Konjugation: Unconjugated
Alternative Synonym: GLUH1, GLUR1, GLURA, GluA1, HBGR1, MRD67, MRT76
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0657]
Molekulargewicht: 102kDa
NCBI: 2890
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Target-Kategorie: GRIA1
Application Verdünnung: WB: WB,1:500 - 1:2000