PAK4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11646T
Artikelname: PAK4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11646T
Hersteller Artikelnummer: CNA11646T
Alternativnummer: MBL-CNA11646T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PAK4 (NP_005875.1).
Konjugation: Unconjugated
Alternative Synonym: PAK4
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 10298
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLD
Target-Kategorie: PAK4
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200