SLC6A5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11647T
Artikelname: SLC6A5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11647T
Hersteller Artikelnummer: CNA11647T
Alternativnummer: MBL-CNA11647T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3).
Konjugation: Unconjugated
Alternative Synonym: NET1, GLYT2, HKPX3, GLYT-2
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 9152
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF
Target-Kategorie: SLC6A5
Application Verdünnung: WB: WB,1:500 - 1:2000