APOBEC3D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11648T
Artikelname: APOBEC3D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11648T
Hersteller Artikelnummer: CNA11648T
Alternativnummer: MBL-CNA11648T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 207-386 of human APOBEC3D (NP_689639.2).
Konjugation: Unconjugated
Alternative Synonym: A3D, A3DE, ARP6, APOBEC3E, APOBEC3DE
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 140564
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ
Target-Kategorie: APOBEC3D
Application Verdünnung: WB: WB,1:500 - 1:2000