Profilin1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA1164S
| Artikelname: |
Profilin1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA1164S |
| Hersteller Artikelnummer: |
CNA1164S |
| Alternativnummer: |
MBL-CNA1164S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Monkey, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human Profilin1 (NP_005013.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ALS18 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
15kDa |
| NCBI: |
5216 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
| Target-Kategorie: |
PFN1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
