CLDN3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11650T
Artikelname: CLDN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11650T
Hersteller Artikelnummer: CNA11650T
Alternativnummer: MBL-CNA11650T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 141-220 of human CLDN3 (NP_001297.1).
Konjugation: Unconjugated
Alternative Synonym: RVP1, HRVP1, C7orf1, CPE-R2, CPETR2
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 1365
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
Target-Kategorie: CLDN3
Application Verdünnung: WB: WB,1:500 - 1:2000