HB-EGF Rabbit mAb, Clone: [ARC0663], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11657S
Artikelname: HB-EGF Rabbit mAb, Clone: [ARC0663], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11657S
Hersteller Artikelnummer: CNA11657S
Alternativnummer: MBL-CNA11657S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075).
Konjugation: Unconjugated
Alternative Synonym: DTR, DTS, DTSF, HEGFL
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0663]
Molekulargewicht: 23kDa
NCBI: 1839
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPV
Target-Kategorie: HBEGF
Application Verdünnung: WB: WB,1:500 - 1:2000