SPRTN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11663T
Artikelname: SPRTN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11663T
Hersteller Artikelnummer: CNA11663T
Alternativnummer: MBL-CNA11663T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human SPRTN (NP_001010984.1).
Konjugation: Unconjugated
Alternative Synonym: DVC1, PRO4323, spartan, C1orf124
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 83932
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKG
Target-Kategorie: SPRTN
Application Verdünnung: WB: WB,1:500 - 1:2000