CD168/RHAMM Rabbit mAb, Clone: [ARC0667], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11666S
Artikelname: CD168/RHAMM Rabbit mAb, Clone: [ARC0667], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11666S
Hersteller Artikelnummer: CNA11666S
Alternativnummer: MBL-CNA11666S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD168/RHAMM (O75330).
Konjugation: Unconjugated
Alternative Synonym: CD168, IHABP, RHAMM
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0667]
Molekulargewicht: 84kDa
NCBI: 3161
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGA
Target-Kategorie: HMMR
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200