CD13/ANPEP Rabbit mAb, Clone: [ARC0670], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11669S
Artikelname: CD13/ANPEP Rabbit mAb, Clone: [ARC0670], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11669S
Hersteller Artikelnummer: CNA11669S
Alternativnummer: MBL-CNA11669S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CD13/ANPEP (P15144).
Konjugation: Unconjugated
Alternative Synonym: APN, AP-M, AP-N, CD13, LAP1, P150, PEPN, hAPN, GP150
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0670]
Molekulargewicht: 110kDa
NCBI: 290
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA
Target-Kategorie: ANPEP
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200