SMPD2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1166T
Artikelname: SMPD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1166T
Hersteller Artikelnummer: CNA1166T
Alternativnummer: MBL-CNA1166T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMPD2 (NP_003071.2).
Konjugation: Unconjugated
Alternative Synonym: ISC1, NSMASE, NSMASE1
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 6610
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYI
Target-Kategorie: SMPD2
Application Verdünnung: WB: WB,1:500 - 1:2000