OLA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11671T
Artikelname: OLA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11671T
Hersteller Artikelnummer: CNA11671T
Alternativnummer: MBL-CNA11671T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human OLA1 (NP_037473.3).
Konjugation: Unconjugated
Alternative Synonym: DOC45, GBP45, GTBP9, GTPBP9, PTD004
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 29789
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFT
Target-Kategorie: OLA1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200