Zinc-alpha2-glycoprotein (ZAG/AZGP1) Rabbit mAb, Clone: [ARC0673], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11680S
Artikelname: Zinc-alpha2-glycoprotein (ZAG/AZGP1) Rabbit mAb, Clone: [ARC0673], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11680S
Hersteller Artikelnummer: CNA11680S
Alternativnummer: MBL-CNA11680S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Zinc-alpha2-glycoprotein (ZAG/AZGP1) (P25311).
Konjugation: Unconjugated
Alternative Synonym: ZAG, ZA2G
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0673]
Molekulargewicht: 34kDa
NCBI: 563
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMET
Target-Kategorie: AZGP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200