Na+/K+-ATPase Rabbit mAb, Clone: [ARC0674], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11683S
Artikelname: Na+/K+-ATPase Rabbit mAb, Clone: [ARC0674], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11683S
Hersteller Artikelnummer: CNA11683S
Alternativnummer: MBL-CNA11683S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Na+/K+-ATPase (P05023).
Konjugation: Unconjugated
Alternative Synonym: CMT2DD, HOMGSMR2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0674]
Molekulargewicht: 113kDa
NCBI: 476
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Target-Kategorie: ATP1A1
Application Verdünnung: WB: WB,1:10000 - 1:120000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200