Glypican 3 (GPC3) Rabbit mAb, Clone: [ARC0675], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11686S
Artikelname: Glypican 3 (GPC3) Rabbit mAb, Clone: [ARC0675], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11686S
Hersteller Artikelnummer: CNA11686S
Alternativnummer: MBL-CNA11686S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-211 of human Glypican 3 (GPC3) (P51654).
Konjugation: Unconjugated
Alternative Synonym: SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0675]
Molekulargewicht: 66kDa
NCBI: 2719
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNF
Target-Kategorie: GPC3
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200