SLC25A12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11688T
Artikelname: SLC25A12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11688T
Hersteller Artikelnummer: CNA11688T
Alternativnummer: MBL-CNA11688T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC25A12 (NP_003696.2).
Konjugation: Unconjugated
Alternative Synonym: AGC1, DEE39, ARALAR, EIEE39
Klonalität: Polyclonal
Molekulargewicht: 75kDa
NCBI: 8604
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
Target-Kategorie: SLC25A12
Application Verdünnung: WB: WB,1:500 - 1:2000