GAS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1168S
Artikelname: GAS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1168S
Hersteller Artikelnummer: CNA1168S
Alternativnummer: MBL-CNA1168S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GAS2 (NP_005247.1).
Konjugation: Unconjugated
Alternative Synonym: GAS-2
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 2620
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKT
Target-Kategorie: GAS2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200