SPR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11694T
Artikelname: SPR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11694T
Hersteller Artikelnummer: CNA11694T
Alternativnummer: MBL-CNA11694T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human SPR (NP_003115.1).
Konjugation: Unconjugated
Alternative Synonym: SDR38C1
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 6697
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGA
Target-Kategorie: SPR
Application Verdünnung: WB: WB,1:500 - 1:2000