MTSS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11697T
Artikelname: MTSS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11697T
Hersteller Artikelnummer: CNA11697T
Alternativnummer: MBL-CNA11697T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-730 of human MTSS1 (NP_055566.3).
Konjugation: Unconjugated
Alternative Synonym: MIM, MIMA, MIMB
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 9788
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQGED
Target-Kategorie: MTSS1
Application Verdünnung: WB: WB,1:500 - 1:2000