HSP47/SERPINH1 Rabbit mAb, Clone: [ARC0681], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11698S
Artikelname: HSP47/SERPINH1 Rabbit mAb, Clone: [ARC0681], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11698S
Hersteller Artikelnummer: CNA11698S
Alternativnummer: MBL-CNA11698S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454).
Konjugation: Unconjugated
Alternative Synonym: CBP1, CBP2, OI10, gp46, AsTP3, HSP47, PIG14, PPROM, RA-A47, SERPINH2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0681]
Molekulargewicht: 46kDa
NCBI: 871
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Target-Kategorie: SERPINH1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200