NMDAR1 Rabbit mAb, Clone: [ARC0684], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11699S
Artikelname: NMDAR1 Rabbit mAb, Clone: [ARC0684], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11699S
Hersteller Artikelnummer: CNA11699S
Alternativnummer: MBL-CNA11699S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NMDAR1 (Q05586).
Konjugation: Unconjugated
Alternative Synonym: NR1, MRD8, GluN1, NMDA1, DEE101, NDHMSD, NDHMSR, NMD-R1, NMDAR1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0684]
Molekulargewicht: 105kDa
NCBI: 2902
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
Target-Kategorie: GRIN1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200