P2RX5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11710T
Artikelname: P2RX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11710T
Hersteller Artikelnummer: CNA11710T
Alternativnummer: MBL-CNA11710T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 341-422 of human P2RX5 (NP_002552.2).
Konjugation: Unconjugated
Alternative Synonym: P2X5, LRH-1, P2X5R
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 5026
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Target-Kategorie: P2RX5
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200