PPP5C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11712T
Artikelname: PPP5C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11712T
Hersteller Artikelnummer: CNA11712T
Alternativnummer: MBL-CNA11712T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human PPP5C (NP_006238.1).
Konjugation: Unconjugated
Alternative Synonym: PP5, PPT, PPP5
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 5536
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY
Target-Kategorie: PPP5C
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200