SPTLC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11716T
Artikelname: SPTLC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11716T
Hersteller Artikelnummer: CNA11716T
Alternativnummer: MBL-CNA11716T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 423-562 of human SPTLC2 (NP_004854.1).
Konjugation: Unconjugated
Alternative Synonym: LCB2, SPT2, HSN1C, LCB2A, NSAN1C, hLCB2a
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 9517
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETED
Target-Kategorie: SPTLC2
Application Verdünnung: WB: WB,1:500 - 1:2000