NACC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11720T
Artikelname: NACC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11720T
Hersteller Artikelnummer: CNA11720T
Alternativnummer: MBL-CNA11720T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-340 of human NACC1 (NP_443108.1).
Konjugation: Unconjugated
Alternative Synonym: NAC1, BEND8, NAC-1, NECFM, BTBD30, BTBD14B
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 112939
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL
Target-Kategorie: NACC1
Application Verdünnung: WB: WB,1:500 - 1:2000