GLUT1/SLC2A1 Rabbit mAb, Clone: [ARC0304], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11727S
Artikelname: GLUT1/SLC2A1 Rabbit mAb, Clone: [ARC0304], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11727S
Hersteller Artikelnummer: CNA11727S
Alternativnummer: MBL-CNA11727S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 393-492 of human GLUT1/SLC2A1 (P11166).
Konjugation: Unconjugated
Alternative Synonym: CSE, PED, DYT9, GLUT, DYT17, DYT18, EIG12, GLUT1, HTLVR, GLUT-1, SDCHCN, GLUT1DS
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0304]
Molekulargewicht: 54kDa
NCBI: 6513
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Target-Kategorie: SLC2A1
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200