GSK3beta Rabbit mAb, Clone: [ARC0251], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11731S
Artikelname: GSK3beta Rabbit mAb, Clone: [ARC0251], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11731S
Hersteller Artikelnummer: CNA11731S
Alternativnummer: MBL-CNA11731S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GSK3beta (P49841).
Konjugation: Unconjugated
Alternative Synonym: GSK3B, glycogen synthase kinase-3 beta
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0251]
Molekulargewicht: 47kDa
NCBI: 2932
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
Target-Kategorie: GSK3B
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200