Connexin 43 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11752P
Artikelname: Connexin 43 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11752P
Hersteller Artikelnummer: CNA11752P
Alternativnummer: MBL-CNA11752P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 233-382 of human Connexin 43 (NP_000156.1).
Konjugation: Unconjugated
Alternative Synonym: HSS, CMDR, CX43, EKVP, GJAL, ODDD, AVSD3, EKVP3, HLHS1, PPKCA
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 2697
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Target-Kategorie: GJA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200