[KO Validated] MMP13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11755T
Artikelname: [KO Validated] MMP13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11755T
Hersteller Artikelnummer: CNA11755T
Alternativnummer: MBL-CNA11755T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 262-471 of human MMP13 (NP_002418.1).
Konjugation: Unconjugated
Alternative Synonym: CLG3, MDST, MANDP1, MMP-13
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 4322
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Target-Kategorie: MMP13
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200