KCNE1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1176S
Artikelname: KCNE1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1176S
Hersteller Artikelnummer: CNA1176S
Alternativnummer: MBL-CNA1176S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNE1 (NP_000210.2).
Konjugation: Unconjugated
Alternative Synonym: ISK, JLNS, LQT5, MinK, JLNS2, LQT2/5
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 3753
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL
Target-Kategorie: KCNE1
Application Verdünnung: WB: WB,1:500 - 1:2000