TLR3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11778P
Artikelname: TLR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11778P
Hersteller Artikelnummer: CNA11778P
Alternativnummer: MBL-CNA11778P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human TLR3 (NP_003256.1).
Konjugation: Unconjugated
Alternative Synonym: CD283, IIAE2, IMD83
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 7098
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA
Target-Kategorie: TLR3
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200