PEDF/SERPINF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11782T
Artikelname: PEDF/SERPINF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11782T
Hersteller Artikelnummer: CNA11782T
Alternativnummer: MBL-CNA11782T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PEDF/SERPINF1 (NP_002606.3).
Konjugation: Unconjugated
Alternative Synonym: OI6, OI12, PEDF, EPC-1, PIG35
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 5176
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD
Target-Kategorie: SERPINF1
Application Verdünnung: WB: WB,1:500 - 1:1000