NOXA2/p67phox Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1178S
Artikelname: NOXA2/p67phox Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1178S
Hersteller Artikelnummer: CNA1178S
Alternativnummer: MBL-CNA1178S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 227-526 of human NOXA2/p67phox (NP_000424.2).
Konjugation: Unconjugated
Alternative Synonym: NCF-2, NOXA2, P67PHOX, P67-PHOX
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 4688
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQE
Target-Kategorie: NCF2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200