RAB5A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1180T
Artikelname: RAB5A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1180T
Hersteller Artikelnummer: CNA1180T
Alternativnummer: MBL-CNA1180T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human RAB5A (NP_004153.2).
Konjugation: Unconjugated
Alternative Synonym: RAB5
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 5868
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Target-Kategorie: RAB5A
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200