ISG15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1182P
Artikelname: ISG15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1182P
Hersteller Artikelnummer: CNA1182P
Alternativnummer: MBL-CNA1182P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1).
Konjugation: Unconjugated
Alternative Synonym: G1P2, IP17, UCRP, IFI15, IMD38, hUCRP
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 9636
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Target-Kategorie: ISG15
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200