TDP-43/TARDB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1183S
Artikelname: TDP-43/TARDB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1183S
Hersteller Artikelnummer: CNA1183S
Alternativnummer: MBL-CNA1183S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human TDP-43/TARDB (NP_031401.1).
Konjugation: Unconjugated
Alternative Synonym: ALS10, TDP-43
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 23435
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGIS
Target-Kategorie: TARDBP
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100|RIP,1:20 - 1:50