Calmodulin 1/2/3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1185P
Artikelname: Calmodulin 1/2/3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1185P
Hersteller Artikelnummer: CNA1185P
Alternativnummer: MBL-CNA1185P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin 1/2/3 (NP_008819.1).
Konjugation: Unconjugated
Alternative Synonym: CALM1,CALML2,CAMI,CPVT4,DD132,LQT14,PHKD,caM
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 801
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target-Kategorie: CALM1
Application Verdünnung: WB: WB,1:500 - 1:1000