S6 Ribosomal Protein (RPS6) Rabbit mAb, Clone: [ARC50655], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11874P
Artikelname: S6 Ribosomal Protein (RPS6) Rabbit mAb, Clone: [ARC50655], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11874P
Hersteller Artikelnummer: CNA11874P
Alternativnummer: MBL-CNA11874P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2).
Konjugation: Unconjugated
Alternative Synonym: S6, eS6
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50655]
Molekulargewicht: 29kDa
NCBI: 6194
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP
Target-Kategorie: RPS6
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200