MMP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1191P
Artikelname: MMP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1191P
Hersteller Artikelnummer: CNA1191P
Alternativnummer: MBL-CNA1191P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1).
Konjugation: Unconjugated
Alternative Synonym: CLG, CLGN
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 4312
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
Target-Kategorie: MMP1
Application Verdünnung: WB: WB,1:500 - 1:1000