beta-Catenin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11932S
Artikelname: beta-Catenin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11932S
Hersteller Artikelnummer: CNA11932S
Alternativnummer: MBL-CNA11932S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (NP_001895.1).
Konjugation: Unconjugated
Alternative Synonym: EVR7, CTNNB, MRD19, NEDSDV, armadillo
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 1499
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Target-Kategorie: CTNNB1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100