HGF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1193S
Artikelname: HGF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1193S
Hersteller Artikelnummer: CNA1193S
Alternativnummer: MBL-CNA1193S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-285 of human HGF (NP_001010933.1).
Konjugation: Unconjugated
Alternative Synonym: SF, HGFB, HPTA, F-TCF, DFNB39
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 3082
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTC
Target-Kategorie: HGF
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200