BET1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11951T
Artikelname: BET1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11951T
Hersteller Artikelnummer: CNA11951T
Alternativnummer: MBL-CNA11951T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2).
Konjugation: Unconjugated
Alternative Synonym: GS15, BET1L1, GOLIM3, HSPC197
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 51272
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAH
Target-Kategorie: BET1L
Application Verdünnung: WB: WB,1:500 - 1:2000